Tuberoinfundibular peptide (PTH2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PTH2 antibody: synthetic peptide directed towards the middle region of human PTH2. Synthetic peptide located within the following region: WADPATPRPRRSLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	11 kDa
Gene Name	parathyroid hormone 2
Database Link	NP_848544 Entrez Gene 113091 Human UniProt ID Q96A98
Background	TIP39 is related to parathyroid hormone (PTH) and PTH-related protein (PTHRP) and is a ligand for PTH receptor-2.TIP39 is related to parathyroid hormone (PTH; MIM 168450) and PTH-related protein (PTHRP; MIM 168470) and is a ligand for PTH receptor-2 (PTHR2; MIM 601469) (John et al., 2002 [PubMed 11861531]). [supplied by OMIM]
Synonyms	TIP39
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%
Reference Data
Protein Families	Secreted Protein, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.