KLB Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-KLB antibody: synthetic peptide directed towards the middle region of human KLB. Synthetic peptide located within the following region: DAYTIRRGLFYVDFNSKQKERKPKSSAHYYKQIIRENGFSLKESTPDVQG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	120 kDa
Gene Name	klotho beta
Database Link	NP_783864 Entrez Gene 152831 Human UniProt ID Q86Z14
Background	KLB is a single-pass type III membrane protein. It contributes to the transcriptional repression of cholesterol 7-alpha-hydroxylase (CYP7A1), the rate-limiting enzyme in bile acid synthesis. KLB is probably inactive as a glycosidase. It increases the ability of FGFR1 and FGFR4 to bind FGF21.
Synonyms	BKL
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Rabbit: 86%; Guinea pig: 85%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.