OR5C1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-OR5C1 antibody is: synthetic peptide directed towards the C-terminal region of Human OR5C1. Synthetic peptide located within the following region: SSSYALDTDKMASVFYTLVIPSLNPLIYSLRNKEVKEALRQTWSRFHCPG
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	olfactory receptor family 5 subfamily C member 1
Database Link	NP_001001923 Entrez Gene 392391 Human UniProt ID Q8NGR4
Background	The function of this protein remains unknown.
Synonyms	OR5C2P; OR9-31; OR9-F
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Mouse: 93%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Olfactory transduction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.