NUDT8 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-NUDT8 antibody is: synthetic peptide directed towards the N-terminal region of Human NUDT8. Synthetic peptide located within the following region: SFPGGKCDPADQDVVHTALRETREELGLAVPEEHVWGLLRPVYDPQKATV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	nudix hydrolase 8
Database Link	NP_862826 Entrez Gene 254552 Human UniProt ID Q8WV74
Background	NUDT8 probably mediates the hydrolysis of some nucleoside diphosphate derivatives.
Synonyms	FLJ41567
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Mouse: 93%; Bovine: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.