NUDT8 Rabbit Polyclonal Antibody
CAT#: TA337475
Rabbit Polyclonal Anti-NUDT8 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-NUDT8 antibody is: synthetic peptide directed towards the N-terminal region of Human NUDT8. Synthetic peptide located within the following region: SFPGGKCDPADQDVVHTALRETREELGLAVPEEHVWGLLRPVYDPQKATV |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 25 kDa |
Gene Name | nudix hydrolase 8 |
Database Link | |
Background | NUDT8 probably mediates the hydrolysis of some nucleoside diphosphate derivatives. |
Synonyms | FLJ41567 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Mouse: 93%; Bovine: 93% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |