KIAA0748 (TESPA1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TESPA1 antibody is: synthetic peptide directed towards the C-terminal region of Human TESPA1. Synthetic peptide located within the following region: SLPIEDPQWSTDPAQIRRELCSLPATNTETHPAKDETFWKRKSRARKSLF
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	42 kDa
Gene Name	thymocyte expressed, positive selection associated 1
Database Link	NP_001092285 Entrez Gene 9840 Human UniProt ID A2RU30
Background	TESPA1 is required for the development and maturation of T-cells, its function being essential for the late stages of thymocyte development. It plays a role in T-cell antigen receptor (TCR)-mediated activation of the ERK and NFAT signaling pathways, possibly by serving as a scaffolding protein that promotes the assembly of the LAT signalosome in thymocytes.
Synonyms	HSPC257; KIAA0748
Note	Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Dog: 93%; Rabbit: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.