GPR89B Rabbit Polyclonal Antibody
CAT#: TA337328
Rabbit Polyclonal Anti-GPR89A Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 7110.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-GPR89A antibody is: synthetic peptide directed towards the C-terminal region of Human GPR89A. Synthetic peptide located within the following region: LEYRTIITEVLGELQFNFYHRWFDVIFLVSALSSILFLYLAHKQAPEKQM |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 53 kDa |
Gene Name | G protein-coupled receptor 89B |
Database Link | |
Background | GPR89A is a nearly identical copy of the GPR89B gene. |
Synonyms | GPHR; GPR89; GPR89C; SH120; UNQ192 |
Note | Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Zebrafish: 93%; Guinea pig: 93% |
Reference Data | |
Protein Families | Druggable Genome, GPCR, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |