FGD5 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-FGD5 antibody is: synthetic peptide directed towards the C-terminal region of Human FGD5. Synthetic peptide located within the following region: FVIKGKVLYTYMASEDKVALESMPLLGFTIAPEKEEGSSEVGPIFHLYHK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	59 kDa
Gene Name	FYVE, RhoGEF and PH domain containing 5
Database Link	NP_689749 Entrez Gene 152273 Human UniProt ID Q6ZNL6
Background	FGD5 activates CDC42, a member of the Ras-like family of Rho- and Rac proteins, by exchanging bound GDP for free GTP. It mediates VEGF-induced CDC42 activation. It may regulate proangiogenic action of VEGF in vascular endothelial cells, including network formation, directional movement and proliferation and may play a role in regulating the actin cytoskeleton and cell shape.
Synonyms	ZFYVE23
Note	Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.