FBXL15 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-FBXL15 antibody is: synthetic peptide directed towards the N-terminal region of Human FBXL15. Synthetic peptide located within the following region: PPMEPSGGEQEPGAVRFLDLPWEDVLLPHVLNRVPLRQLLRLQRVSRAFR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	F-box and leucine-rich repeat protein 15
Database Link	NP_077302 Entrez Gene 79176 Human UniProt ID Q9H469
Background	FBXL15 is a substrate recognition component of a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of SMURF1, thereby acting as a positive regulator of the BMP signaling pathway. It is required for dorsal/ventral pattern formation and bone mass maintenance and also mediates ubiquitination of SMURF2 and WWP2.
Synonyms	Fbl15; FBXO37; JET; PSD
Note	Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Rat: 93%; Goat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 86%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.