BTBD14A (NACC2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-BTBD14A antibody: synthetic peptide directed towards the C terminal of human BTBD14A. Synthetic peptide located within the following region: FEQRIYAERRGDAATIVALRTDAVNVDLSAAANPAFDAGEEVDGAGSVIQ
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	63 kDa
Gene Name	NACC family member 2
Database Link	NP_653254 Entrez Gene 138151 Human UniProt ID Q96BF6
Background	cDNA sequence was generated by The National Institutes of Health Mammalian Gene Collection (MGC) Program.
Synonyms	BEND9; BTBD14; BTBD14A; BTBD31; NAC-2; RBB
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Bovine: 86%; Pig: 79%; Horse: 79%; Mouse: 79%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.