RIN3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RIN3 antibody: synthetic peptide directed towards the N terminal of human RIN3. Synthetic peptide located within the following region: AGMFLVRRDSSSKQLVLCVHFPSLNESSAEVLEYTIKEEKSILYLEGSAL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	108 kDa
Gene Name	Ras and Rab interactor 3
Database Link	NP_079108 Entrez Gene 79890 Human UniProt ID Q8TB24
Background	RIN3, biochemically characterized as the stimulator and stabilizer for GTP-Rab5, plays an important role in the transport pathway from plasma membrane to early endosomes.
Synonyms	DKFZp762H1613; FLJ11700; FLJ22439
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Bovine: 93%; Horse: 92%; Rat: 90%; Mouse: 79%; Dog: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.