DMTF1 Rabbit Polyclonal Antibody
CAT#: TA337244
Rabbit Polyclonal Anti-DMTF1 Antibody
Need it in bulk or conjugated? 
                            Get a free quote
                        
CNY 5250.00
CNY 3080.00
                                                
                                                
                                                
                                                    CNY 300.00 
                                                    
                                                    CNY 1430.00
                                                
                                            
Specifications
| Product Data | |
| Applications | IHC, WB | 
| Recommend Dilution | WB, IHC | 
| Reactivity | Human | 
| Host | Rabbit | 
| Clonality | Polyclonal | 
| Immunogen | The immunogen for anti-DMTF1 antibody: synthetic peptide directed towards the C terminal of human DMTF1. Synthetic peptide located within the following region: SFNDAHVSKFSDQNSTELMNSVMVRTEEEISDTDLKQEESPSDLASAYVT | 
| Isotype | IgG | 
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. | 
| Purification | Affinity Purified | 
| Conjugation | Unconjugated | 
| Storage Condition | Store at -20°C as received. | 
| Predicted Protein Size | 54 kDa | 
| Gene Name | cyclin D binding myb like transcription factor 1 | 
| Database Link | |
| Background | DMTF1 binds specifically to the nonamer DNA consensus sequences CCCG(G/T)ATGT to activate transcription. | 
| Synonyms | DMP1; DMTF; hDMP1; MRUL | 
| Note | Immunogen Sequence Homology: Human: 100%; Dog: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Rabbit: 92%; Pig: 91%; Guinea pig: 91% | 
| Reference Data | |
| Protein Families | Transcription Factors | 
Documents
| Product Manuals | 
| FAQs | 
| SDS | 
Resources
| 抗体相关资料 | 
