DMTF1 Rabbit Polyclonal Antibody
CAT#: TA337244
Rabbit Polyclonal Anti-DMTF1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-DMTF1 antibody: synthetic peptide directed towards the C terminal of human DMTF1. Synthetic peptide located within the following region: SFNDAHVSKFSDQNSTELMNSVMVRTEEEISDTDLKQEESPSDLASAYVT |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 54 kDa |
Gene Name | cyclin D binding myb like transcription factor 1 |
Database Link | |
Background | DMTF1 binds specifically to the nonamer DNA consensus sequences CCCG(G/T)ATGT to activate transcription. |
Synonyms | DMP1; DMTF; hDMP1; MRUL |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Rabbit: 92%; Pig: 91%; Guinea pig: 91% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |