DCP1A Rabbit Polyclonal Antibody
CAT#: TA337231
Rabbit Polyclonal Anti-DCP1A Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4537.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-DCP1A antibody: synthetic peptide directed towards the N terminal of human DCP1A. Synthetic peptide located within the following region: EEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGD |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 56 kDa |
| Gene Name | decapping mRNA 1A |
| Database Link | |
| Background | Decapping is a key step in general and regulated mRNA decay. The protein encoded by this gene is a decapping enzyme. This protein and another decapping enzyme form a decapping complex, which interacts with the nonsense-mediated decay factor hUpf1 and may be recruited to mRNAs containing premature termination codons. This protein also participates in the TGF-beta signaling pathway. |
| Synonyms | HSA275986; Nbla00360; SMAD4IP1; SMIF |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 92% |
| Reference Data | |
| Protein Families | Transcription Factors |
| Protein Pathways | RNA degradation |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
