C1orf181 (ZNHIT6) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FLJ20729 antibody: synthetic peptide directed towards the C terminal of human FLJ20729. Synthetic peptide located within the following region: PISNKYMYFMKNRARRQGINLKLLPNGFTKRKENSTFFDKKKQQFCWHVK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	54 kDa
Gene Name	zinc finger HIT-type containing 6
Database Link	NP_060423 Entrez Gene 54680 Human UniProt ID Q9NWK9
Background	TRMT1 is a tRNA(m(2)(2)G(26))dimethyltransferase
Synonyms	BCD1; C1orf181; NY-BR-75
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.