EMA (MUC1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	FC, ICC/IF, IHC, WB
Recommend Dilution	Knockout Validated, Western Blot: 0.2-1 ug/ml, Immunocytochemistry/ Immunofluorescence: 1:10-1:500, Immunohistochemistry: 1:10-1:500, Flow Cytometry, Immunohistochemistry-Paraffin: 4-8 ug/ml
Reactivity	Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine
Host	Rabbit
Clonality	Polyclonal
Immunogen	Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL.
Formulation	PBS, 0.02% Sodium Azide. Store at -20C. Avoid freeze-thaw cycles.
Concentration	lot specific
Purification	Affinity purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	122 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Gene Name	mucin 1, cell surface associated
Database Link	NP_002447 Entrez Gene 17829 MouseEntrez Gene 24571 RatEntrez Gene 4582 Human UniProt ID P15941
Background	MUC1 is a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas.
Synonyms	ADMCKD; ADMCKD1; CA 15-3; CD227; EMA; H23AG; KL-6; MAM6; MCD; MCKD; MCKD1; MUC-1; SEC
Reference Data
Protein Families	Druggable Genome, Secreted Protein, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.