EMA (MUC1) Rabbit Polyclonal Antibody
CNY 5381.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 3080.00
Specifications
Product Data | |
Applications | FC, ICC/IF, IHC, WB |
Recommend Dilution | Knockout Validated, Western Blot: 0.2-1 ug/ml, Immunocytochemistry/ Immunofluorescence: 1:10-1:500, Immunohistochemistry: 1:10-1:500, Flow Cytometry, Immunohistochemistry-Paraffin: 4-8 ug/ml |
Reactivity | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Formulation | PBS, 0.02% Sodium Azide. Store at -20C. Avoid freeze-thaw cycles. |
Concentration | lot specific |
Purification | Affinity purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 122 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Gene Name | mucin 1, cell surface associated |
Database Link | |
Background | MUC1 is a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas. |
Synonyms | ADMCKD; ADMCKD1; CA 15-3; CD227; EMA; H23AG; KL-6; MAM6; MCD; MCKD; MCKD1; MUC-1; SEC |
Reference Data | |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |