Glutathione Reductase (GSR) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IF, WB
Recommend Dilution	WB, IF
Reactivity	Human, Mouse, Zebrafish
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-GSR Antibody: synthetic peptide directed towards the N terminal of human GSR. Synthetic peptide located within the following region: PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	56 kDa
Gene Name	glutathione reductase
Database Link	NP_000628 Entrez Gene 14782 MouseEntrez Gene 2936 Human UniProt ID P00390
Background	GSR belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family. It maintains high levels of reduced glutathione in the cytosol. Both glutathione and glutathione reductase are inducible by D3T, and that upregulation of GSH biosynthesis underlies D3T-mediated cytoprotection against ROS/RNS-elicited injury to human vascular smooth muscle cells.
Synonyms	HEL-75
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Bovine: 93%; Horse: 86%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Glutathione metabolism

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.