LRRC52 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-LRRC52 Antibody: synthetic peptide directed towards the N terminal of human LRRC52. Synthetic peptide located within the following region: QEVICTGKQLTEYPLDIPLNTRRLFLNENRITSLPAMHLGLLSDLVYLDC
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	leucine rich repeat containing 52
Database Link	NP_001005214 Entrez Gene 440699 Human UniProt ID Q8N7C0
Background	The function of this protein remains unknown.
Synonyms	FLJ25811
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Pig: 92%; Rat: 92%; Bovine: 92%; Mouse: 83%; Guinea pig: 83%; Dog: 75%; Horse: 75%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.