Glycoprotein 2 (GP2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-GP2 Antibody: synthetic peptide directed towards the middle region of human GP2. Synthetic peptide located within the following region: SLQAALQPIVSSLNVSVDGNGEFIVRMALFQDQNYTNPYEGDAVELSVES
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	glycoprotein 2
Database Link	NP_001007242 Entrez Gene 2813 Human UniProt ID P55259
Background	GP2 is component of pancreatic secretory (zymogen) granule. The exact function of GP2 remains unknown.
Synonyms	ZAP75
Note	Immunogen Sequence Homology: Human: 100%; Rat: 92%; Horse: 92%; Mouse: 92%; Pig: 79%; Bovine: 79%
Reference Data
Protein Families	Druggable Genome, Secreted Protein, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.