NIPA2 Rabbit Polyclonal Antibody
CAT#: TA336140
Rabbit Polyclonal Anti-NIPA2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 3080.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-NIPA2 Antibody: synthetic peptide directed towards the middle region of human NIPA2. Synthetic peptide located within the following region: VYITICSVIGAFSVSCVKGLGIAIKELFAGKPVLRHPLAWILLLSLIVCV |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 39 kDa |
Gene Name | non imprinted in Prader-Willi/Angelman syndrome 2 |
Database Link | |
Background | NIPA2 belongs to the NIPA family. It is a multi-pass membrane protein. The function of the NIPA2 protein remains unknown. |
Synonyms | MGC5466 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Bovine: 93%; Rat: 86%; Mouse: 86%; Zebrafish: 85%; Guinea pig: 79% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |