LST 3TM12 (SLCO1B7) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-LST-3TM12 Antibody: synthetic peptide directed towards the middle region of human LST-3TM12. Synthetic peptide located within the following region: RAFFGLKVALIFPVLVLLTVFIFVVRKKSHGKDTKVLENERQVMDEANLE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	71 kDa
Gene Name	solute carrier organic anion transporter family member 1B7 (putative)
Database Link	NP_001009562 Entrez Gene 338821 Human UniProt ID G3V0H7
Background	The exact function of LST-3TM12 remains unknown.
Synonyms	LST-3; LST-3TM12; LST3; SLC21A21
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.