LRRC26 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-LRRC26 Antibody: synthetic peptide directed towards the middle region of human LRRC26. Synthetic peptide located within the following region: LRPLCAWLRRHPLPASEAETVLCVWPGRLTLSPLTAFSDAAFSHCAQPLA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	leucine rich repeat containing 26
Database Link	NP_001013675 Entrez Gene 389816 Human UniProt ID Q2I0M4
Background	The function remains unknown.
Synonyms	bA350O14.10; CAPC
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Bovine: 93%; Horse: 83%; Pig: 77%; Guinea pig: 77%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.