CYB5RL Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CYB5RL Antibody: synthetic peptide directed towards the N terminal of human LOC606495. Synthetic peptide located within the following region: KLNPETFVAFCIIAMDRLTKDTYRVRFALPGNSQLGLRPGQHLILRGIVD
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	cytochrome b5 reductase like
Database Link	NP_001026842 Entrez Gene 606495 Human UniProt ID Q6IPT4
Background	The specific function of this protein remains unknown.
Synonyms	FLJ16295
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.