DNAJB14 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-DNAJB14 Antibody is: synthetic peptide directed towards the N-terminal region of Human DNAJB14. Synthetic peptide located within the following region: SGDQSKPNCTKDSTSGSGEGGKGYTKDQVDGVLSINKCKNYYEVLGVTKD
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	42 kDa
Gene Name	DnaJ heat shock protein family (Hsp40) member B14
Database Link	NP_001026893 Entrez Gene 79982 Human UniProt ID Q8TBM8
Background	DNAJB14 may act as a co-chaperone.
Synonyms	EGNR9427; PRO34683
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Dog: 92%; Horse: 86%; Rat: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.