CNGA4 Rabbit Polyclonal Antibody
CAT#: TA336009
Rabbit Polyclonal Anti-CNGA4 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 4840.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-CNGA4 Antibody is: synthetic peptide directed towards the N-terminal region of Human CNGA4. Synthetic peptide located within the following region: RIAKLMLYIFVVIHWNSCLYFALSRYLGFGRDAWVYPDPAQPGFERLRRQ |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 45 kDa |
Gene Name | cyclic nucleotide gated channel alpha 4 |
Database Link | |
Background | CNGA4 is a modulatory subunit of vertebrate cyclic nucleotide-gated membrane channels that transduce odorant signals? |
Synonyms | CNCA2; CNG-4; CNG4; CNG5; CNGB2; OCNC2; OCNCb; OCNCBETA |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Druggable Genome, Ion Channels: Cyclic nucleotide gated, Transmembrane |
Protein Pathways | Olfactory transduction |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |