C19orf46 (SYNE4) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-C19orf46 Antibody: synthetic peptide directed towards the N terminal of human C19orf46. Synthetic peptide located within the following region: GEESTSPEQAQTLGQDSLGPPEHFQGGPRGNEPAAHPPRWSTPSSYEDPA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	spectrin repeat containing nuclear envelope family member 4
Database Link	NP_001034965 Entrez Gene 163183 Human UniProt ID Q8N205
Background	The exact function of C19orf46 remains unknown.
Synonyms	C19orf46; DFNB76; Nesp4
Note	Immunogen Sequence Homology: Human: 100%; Horse: 85%; Bovine: 85%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.