FAM3C Rabbit Polyclonal Antibody
CAT#: TA335977
Rabbit Polyclonal Anti-FAM3C Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 9998.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-FAM3C Antibody: synthetic peptide directed towards the C terminal of human FAM3C. Synthetic peptide located within the following region: DNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 22 kDa |
Gene Name | family with sequence similarity 3 member C |
Database Link | |
Background | FAM3C is a secreted protein with a GG domain. A change in expression of this protein has been noted in pancreatic cancer-derived cells.This gene is a member of the family with sequence similarity 3 (FAM3) family and encodes a secreted protein with a GG domain. A change in expression of this protein has been noted in pancreatic cancer-derived cells. Alternate transcriptional splice variants which encode the same protein have been characterized. |
Synonyms | GS3786; ILEI |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Horse: 93%; Mouse: 93%; Rabbit: 91%; Zebrafish: 86% |
Reference Data | |
Protein Families | Secreted Protein, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |