RALGDS Rabbit Polyclonal Antibody
CAT#: TA335961
Rabbit Polyclonal Anti-RALGDS Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
Cited in 1 publication. |
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 4840.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-RALGDS Antibody: synthetic peptide directed towards the N terminal of human RALGDS. Synthetic peptide located within the following region: KRYGRCDALTASSRYGCILPYSDEDGGPQDQLKNAISSILGTWLDQYSED |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 95 kDa |
Gene Name | ral guanine nucleotide dissociation stimulator |
Database Link | |
Background | The specific function of this protein remains unknown. |
Synonyms | RalGEF; RGDS; RGF |
Note | Immunogen Sequence Homology: Dog: 100%; Human: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%; Pig: 86%; Guinea pig: 86% |
Reference Data | |
Protein Pathways | Colorectal cancer, Pancreatic cancer, Pathways in cancer |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
KRAS regulation by small non-coding RNAs and SNARE proteins
,Che, Y;Siprashvili, Z;Kovalski, JR;Jiang, T;Wozniak, G;Elcavage, L;Khavari, PA;,
Nat Commun
,PubMed ID 31712554
[RALGDS]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |