PTPN20B (PTPN20) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PTPN20A Antibody is: synthetic peptide directed towards the middle region of Human PTPN20A. Synthetic peptide located within the following region: LEEKTAAYDIMQEFMALELKNLPGEFNSGNQPSNREKNRYRDILPYDSTR
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	protein tyrosine phosphatase, non-receptor type 20
Database Link	NP_001035854 Entrez Gene 653129 Entrez Gene 26095 Human UniProt ID Q4JDL3
Background	The product of this gene belongs to the family of classical tyrosine-specific protein tyrosine phosphatases. Many protein tyrosine phosphatases have been shown to regulate fundamental cellular processes and several are mutated in human diseases. Chromosome 10q contains a segmental duplication resulting in multiple copies of the protein tyrosine phosphatase, non-receptor type 20 gene. The two nearly identical copies are designated as PTPN20A and PTPN20B. A third copy is only partially duplicated and contains a pseudogene, designated as PTPN20C. This gene encodes the more centromeric copy, PTPN20A. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.
Synonyms	bA142I17.1; CT126; hPTPN20; PTPN20B
Note	Immunogen Sequence Homology: Human: 100%; Pig: 79%; Zebrafish: 77%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.