HMGCLL1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-HMGCLL1 Antibody: synthetic peptide directed towards the N terminal of human HMGCLL1. Synthetic peptide located within the following region: MGNVPSAVKHCLSYQQLLREHLWIGDSVAGALDPAQETSQLSGLPEFVKI
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	3-hydroxymethyl-3-methylglutaryl-CoA lyase-like 1
Database Link	NP_001035865 Entrez Gene 54511 Human UniProt ID Q8TB92
Background	HMGCLL1 is involved in the catabolism of branched amino acids such as leucine.
Synonyms	bA418P12.1; er-cHL
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Rabbit: 100%; Rat: 92%; Mouse: 92%; Bovine: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.