C14ORF140 (ZC2HC1C) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZC2HC1C Antibody: synthetic peptide directed towards the N terminal of human ZC2HC1C. Synthetic peptide located within the following region: QQDPESDSQGQGNGLFYSSGPQSWYPKANNQDFIPFTKKRVGVDRAFPLK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	31 kDa
Gene Name	zinc finger C2HC-type containing 1C
Database Link	NP_001035895 Entrez Gene 79696 Human UniProt ID Q53FD0
Background	ZC2HC1C belongs to the UPF0418 family. The exact function of ZC2HC1C remains unknown.
Synonyms	C14orf140; FAM164C
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Dog: 93%; Pig: 86%; Rat: 86%; Mouse: 79%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.