ACBD5 Rabbit Polyclonal Antibody
CAT#: TA335956
Rabbit Polyclonal Anti-ACBD5 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-ACBD5 Antibody: synthetic peptide directed towards the C terminal of human ACBD5. Synthetic peptide located within the following region: VRRGRGHRMQHLSEGTKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLMR |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 55 kDa |
Gene Name | acyl-CoA binding domain containing 5 |
Database Link | |
Background | ACBD5 contains 1 ACB (acyl-CoA-binding) domain. The function of the ACBD5 protein is not known. |
Synonyms | DKFZp434A2417; KIAA1996 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Horse: 93%; Rabbit: 93%; Guinea pig: 93% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |