C19orf28 (MFSD12) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-C19orf28 Antibody: synthetic peptide directed towards the middle region of human C19orf28. Synthetic peptide located within the following region: VELTALRYAFTVVANITVYGAAWLLLHLQGSSRVEPTQDISISDQLGGQD
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	51 kDa
Gene Name	major facilitator superfamily domain containing 12
Database Link	NP_001036145 Entrez Gene 126321 Human UniProt ID Q6NUT3
Background	The function remains known.
Synonyms	C19orf28; PP3501
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.