ALS2CR4 (TMEM237) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ALS2CR4 Antibody: synthetic peptide directed towards the middle region of human ALS2CR4. Synthetic peptide located within the following region: AGDQLSNLSNLLQQYKTLAYPFQSLLYLLLALSTISAFDRIDFAKISVAI
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	45 kDa
Gene Name	transmembrane protein 237
Database Link	NP_001037850 Entrez Gene 65062 Human UniProt ID Q96Q45
Background	The function of this protein remains unknown.
Synonyms	ALS2CR4; JBTS14
Note	Immunogen Sequence Homology: Human: 100%; Horse: 93%; Rabbit: 93%; Mouse: 92%; Pig: 86%; Rat: 86%; Bovine: 86%; Dog: 85%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.