IMPDH1 Rabbit Polyclonal Antibody
CAT#: TA335913
Rabbit Polyclonal Anti-IMPDH1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5200.00
CNY 4840.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-IMPDH1 Antibody is: synthetic peptide directed towards the C-terminal region of IMPDH1. Synthetic peptide located within the following region: DGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSI |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 63 kDa |
Gene Name | IMP (inosine 5'-monophosphate) dehydrogenase 1 |
Database Link | |
Background | The protein encoded by this gene acts as a homotetramer to regulate cell growth. The encoded protein is an enzyme that catalyzes the synthesis of xanthine monophosphate (XMP) from inosine-5'-monophosphate (IMP). This is the rate-limiting step in the de novo synthesis of guanine nucleotides. Defects in this gene are a cause of retinitis pigmentosa type 10 (RP10). Several transcript variants encoding different isoforms have been found for this gene. |
Synonyms | IMPD; IMPD1; LCA11; RP10; sWSS2608 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Drug metabolism - other enzymes, Metabolic pathways, Purine metabolism |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |