CDKN1A interacting zinc finger protein 1 (CIZ1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CIZ1 Antibody: synthetic peptide directed towards the middle region of human CIZ1. Synthetic peptide located within the following region: YICRICHKFYHSNSGAQLSHCKSLGHFENLQKYKAAKNPSPTTRPVSRRC
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	91 kDa
Gene Name	CDKN1A interacting zinc finger protein 1
Database Link	NP_001124490 Entrez Gene 25792 Human UniProt ID Q9ULV3
Background	CIZ1 may regulate the subcellular localization of CIP/WAF1.
Synonyms	LSFR1; NP94; ZNF356
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Bovine: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.