FAM111B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-FAM111B Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM111B. Synthetic peptide located within the following region: GFNVHALIEFGYSMDSILCDIKKTNESLYKSLNDEKLETYDEEKGKQESS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	81 kDa
Gene Name	family with sequence similarity 111 member B
Database Link	NP_001136175 Entrez Gene 374393 Human UniProt ID Q6SJ93
Background	The function of this protein remains unknown.
Synonyms	CANP; POIKTMP
Note	Immunogen Sequence Homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.