MAX Rabbit Polyclonal Antibody
CNY 4537.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse, Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-MAX Antibody: synthetic peptide directed towards the middle region of human MAX. Synthetic peptide located within the following region: LQTNYPSSDNSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 18 kDa |
Gene Name | MYC associated factor X |
Database Link | |
Background | MAX is a member of the basic helix-loop-helix leucine zipper (bHLHZ) family of transcription factors. It is able to form homodimers and heterodimers with other family members, which include Mad, Mxi1 and Myc. Myc is an oncoprotein implicated in cell proliferation, differentiation and apoptosis. The homodimers and heterodimers compete for a common DNA target site (the E box) and rearrangement among these dimer forms provides a complex system of transcriptional regulation.The protein encoded by this gene is a member of the basic helix-loop-helix leucine zipper (bHLHZ) family of transcription factors. It is able to form homodimers and heterodimers with other family members, which include Mad, Mxi1 and Myc. Myc is an oncoprotein implicated in cell proliferation, differentiation and apoptosis. The homodimers and heterodimers compete for a common DNA target site (the E box) and rearrangement among these dimer forms provides a complex system of transcriptional regulation. Multiple alternatively spliced transcript variants have been described for this gene but the full length nature for some of them is unknown. |
Synonyms | bHLHd4 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Zebrafish: 79% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | MAPK signaling pathway, Pathways in cancer, Small cell lung cancer |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |