MGAT2 Rabbit Polyclonal Antibody
CAT#: TA335833
Rabbit Polyclonal Anti-MGAT2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-MGAT2 Antibody: synthetic peptide directed towards the middle region of human MGAT2. Synthetic peptide located within the following region: PKNAALKLGCINAEYPDSFGHYREAKFSQTKHHWWWKLHFVWERVKILRD |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 51 kDa |
Gene Name | mannosyl (alpha-1,6-)-glycoprotein beta-1,2-N-acetylglucosaminyltransferase |
Database Link | |
Background | MGAT2 is a Golgi enzyme catalyzing an essential step in the conversion of oligomannose to complex N-glycans. The enzyme has the typical glycosyltransferase domains: a short N-terminal cytoplasmic domain, a hydrophobic non-cleavable signal-anchor domain, and a C-terminal catalytic domain. Mutations in its gene may lead to carbohydrate-deficient glycoprotein syndrome, type II.The product of this gene is a Golgi enzyme catalyzing an essential step in the conversion of oligomannose to complex N-glycans. The enzyme has the typical glycosyltransferase domains: a short N-terminal cytoplasmic domain, a hydrophobic non-cleavable signal-anchor domain, and a C-terminal catalytic domain. Mutations in this gene may lead to carbohydrate-deficient glycoprotein syndrome, type II. Two transcript variants encoding the same protein have been identified for this gene. |
Synonyms | CDG2A; CDGS2; GLCNACTII; GNT-II; GNT2 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | Metabolic pathways, N-Glycan biosynthesis |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |