MNAT1 Rabbit Polyclonal Antibody

CAT#: TA335831

Rabbit Polyclonal Anti-MNAT1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4537.00


货期*
2周

规格
    • 100 ug

Product images

推荐一起购买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human menage a trois homolog 1, cyclin H assembly factor (Xenopus laevis) (MNAT1), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of menage a trois homolog 1, cyclin H assembly factor (Xenopus laevis) (MNAT1), transcript variant 2
    • 100 ug

CNY 3080.00


Recombinant protein of human menage a trois homolog 1, cyclin H assembly factor (Xenopus laevis) (MNAT1), 100 µg
    • 100 ug

CNY 9998.00


Transient overexpression lysate of menage a trois homolog 1, cyclin H assembly factor (Xenopus laevis) (MNAT1)
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-MNAT1 Antibody: synthetic peptide directed towards the C terminal of human MNAT1. Synthetic peptide located within the following region: LQIETYGPHVPELEMLGRLGYLNHVRAASPQDLAGGYTSSLACHRALQDA
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 36 kDa
Gene Name MNAT1, CDK activating kinase assembly factor
Background Cyclin-dependent kinases (CDKs), which play an essential role in cell cycle control of eukaryotic cells, are phosphorylated and thus activated by the CDK-activating kinase (CAK). CAK is a multisubunit protein that includes CDK7, cyclin H, and MAT1. MAT1 (for 'menage a trois-1') is involved in the assembly of the CAK complex.Cyclin-dependent kinases (CDKs), which play an essential role in cell cycle control of eukaryotic cells, are phosphorylated and thus activated by the CDK-activating kinase (CAK). CAK is a multisubunit protein that includes CDK7 (MIM 601955), cyclin H (CCNH; MIM 601953), and MAT1. MAT1 (for 'menage a trois-1') is involved in the assembly of the CAK complex. [supplied by OMIM]
Synonyms CAP35; MAT1; RNF66; TFB3
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%
Reference Data
Protein Families Druggable Genome, Stem cell - Pluripotency, Transcription Factors
Protein Pathways Nucleotide excision repair
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...