PSMC2 Rabbit Polyclonal Antibody
CAT#: TA335805
Rabbit Polyclonal Anti-PSMC2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4537.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-PSMC2 Antibody: synthetic peptide directed towards the N terminal of human PSMC2. Synthetic peptide located within the following region: MPDYLGADQRKTKEVEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVED |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 49 kDa |
| Gene Name | proteasome 26S subunit, ATPase 2 |
| Database Link | |
| Background | PSMC2 is one of the ATPase subunits. This subunit has been shown to interact with several of the basal transcription factors so, in addition to participation in proteasome functions, this subunit may participate in the regulation of transcription. This su |
| Synonyms | MSS1; Nbla10058; S7 |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Zebrafish: 93% |
| Reference Data | |
| Protein Pathways | Proteasome |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
