HOXB7 Rabbit Polyclonal Antibody

CAT#: TA335745

Rabbit Polyclonal Anti-HOXB7 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of homeobox B7 (HOXB7)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human homeobox B7 (HOXB7), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human homeobox B7 (HOXB7), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications IF, WB
Recommend Dilution WB, IF
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-HOXB7 Antibody: synthetic peptide directed towards the C terminal of human HOXB7. Synthetic peptide located within the following region: IEIAHTLCLTERQIKIWFQNRRMKWKKENKTAGPGTTGQDRAEAEEEEEE
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 24 kDa
Gene Name homeobox B7
Background HOXB7 belongs to the homeobox family. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXBThis gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma.
Synonyms HHO.C1; Hox-2.3; HOX2; HOX2C
Note Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Mouse: 92%; Rat: 85%; Horse: 79%; Dog: 77%
Reference Data
Protein Families Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...