COLQ Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-COLQ Antibody: synthetic peptide directed towards the N terminal of human COLQ. Synthetic peptide located within the following region: LQLFFLSIVSQPTFINSVLPISAALPSLDQKKRGGHKACCLLTPPPPPLF
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	48 kDa
Gene Name	collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase
Database Link	NP_005668 Entrez Gene 8292 Human UniProt ID Q9Y215
Background	COLQ encodes the subunit of a collagen-like molecule associated with acetylcholinesterase in skeletal muscle. Each molecule is composed of three identical subunits. Each subunit contains a proline-rich attachment domain (PRAD) that binds an acetylcholinesterase tetramer to anchor the catalytic subunit of the enzyme to the basal lamina. Mutations in COLQ are associated with endplate acetylcholinesterase deficiency.
Synonyms	EAD
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Horse: 93%; Rabbit: 93%; Mouse: 92%; Bovine: 86%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.