HEXIM1 Rabbit Polyclonal Antibody
CAT#: TA335686
Rabbit Polyclonal Anti-HEXIM1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4537.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-HEXIM1 Antibody: synthetic peptide directed towards the C terminal of human HEXIM1. Synthetic peptide located within the following region: LESKRLGGDDARVRELELELDRLRAENLQLLTENELHRQQERAPLSKFGD |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 41 kDa |
Gene Name | hexamethylene bis-acetamide inducible 1 |
Database Link | |
Background | HEXIM1 expression is induced by hexamethylene-bis-acetamide in vascular smooth muscle cells. The function of this protein is not yet known. |
Synonyms | CLP1; EDG1; HIS1; MAQ1 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%; Yeast: 82%; Zebrafish: 80% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |