CCT6B Rabbit Polyclonal Antibody

CAT#: TA335679

Rabbit Polyclonal Anti-CCT6B Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human chaperonin containing TCP1, subunit 6B (zeta 2) (CCT6B), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of chaperonin containing TCP1, subunit 6B (zeta 2) (CCT6B), transcript variant 2
    • 100 ug

CNY 3080.00


Recombinant protein of human chaperonin containing TCP1, subunit 6B (zeta 2) (CCT6B), 100 µg
    • 100 ug

CNY 9998.00


Transient overexpression lysate of chaperonin containing TCP1, subunit 6B (zeta 2) (CCT6B)
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-CCT6B Antibody: synthetic peptide directed towards the N terminal of human CCT6B. Synthetic peptide located within the following region: VARTSLQTKVHAELADVLTEVVVDSVLAVRRPGYPIDLFMVEIMEMKHKL
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 58 kDa
Gene Name chaperonin containing TCP1 subunit 6B
Background CCT6B is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin.This gene encodes a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.
Synonyms CCT-zeta-2; CCTZ-2; Cctz2; TCP-1-zeta-2; TSA303
Note Immunogen Sequence Homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 93%; Rabbit: 93%; Rat: 86%; Horse: 86%; Mouse: 86%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...