USF1 Rabbit Polyclonal Antibody

CAT#: TA335665

Rabbit Polyclonal Anti-USF1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human upstream transcription factor 1 (USF1), transcript variant 2, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of upstream transcription factor 1 (USF1), transcript variant 2
    • 100 ug

CNY 3080.00


Recombinant protein of human upstream transcription factor 1 (USF1), transcript variant 1, 100 µg
    • 100 ug

CNY 9998.00


Transient overexpression lysate of upstream transcription factor 1 (USF1), transcript variant 1
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human, Mouse
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-USF1 Antibody: synthetic peptide directed towards the N terminal of human USF1. Synthetic peptide located within the following region: KGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVF
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 33 kDa
Gene Name upstream transcription factor 1
Background USF1 is a member of the basic helix-loop-helix leucine zipper family, and can function as a cellular transcription factor. USF1 can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs. This gene has been linked to familial combined hyperlipidemia (FCHL).This gene encodes a member of the basic helix-loop-helix leucine zipper family, and can function as a cellular transcription factor. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs. This gene has been linked to familial combined hyperlipidemia (FCHL). Two transcript variants encoding distinct isoforms have been identified for this gene.
Synonyms bHLHb11; FCHL; FCHL1; HYPLIP1; MLTF; MLTFI; UEF
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families Druggable Genome, Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...