FEM 1B (FEM1B) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-FEM1B Antibody: synthetic peptide directed towards the C terminal of human FEM1B. Synthetic peptide located within the following region: DKSTTGVSEILLKTQMKMSLKCLAARAVRANDINYQDQIPRTLEEFVGFH
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	69 kDa
Gene Name	fem-1 homolog B
Database Link	NP_056137 Entrez Gene 10116 Human UniProt ID Q9UK73
Background	FEM1B is a component of an E3 ubiquitin-protein ligase complex, in which it may act as a substrate recognition subunit. It involved in apoptosis by acting as a death receptor-associated protein that mediates apoptosis. FEM1B also involved in glucose homeostasis in pancreatic islet.
Synonyms	F1A-ALPHA; F1AA; FEM1-beta
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.