SETD4 Rabbit Polyclonal Antibody
CAT#: TA335545
Rabbit Polyclonal Anti-SETD4 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 4840.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-SETD4 Antibody: synthetic peptide directed towards the C terminal of human SETD4. Synthetic peptide located within the following region: VQVKAAFNEETHSYEIRTTSRWRKHEEVFICYGPHDNQRLFLEYGFVSVH |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 32 kDa |
Gene Name | SET domain containing 4 |
Database Link | |
Background | SETD4 contains 1 SET domain. The exact function of SETD4 is not known. |
Synonyms | C21orf18; C21orf27 |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rat: 86%; Bovine: 86%; Guinea pig: 86%; Dog: 80%; Mouse: 79%; Rabbit: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |