Fascin 3 (FSCN3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-FSCN3 Antibody: synthetic peptide directed towards the middle region of human FSCN3. Synthetic peptide located within the following region: WGKFALNFCIELQGSNLLTVLAPNGFYMRADQSGTLLADSEDITRECIWE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	55 kDa
Gene Name	fascin actin-bundling protein 3
Database Link	NP_065102 Entrez Gene 29999 Human UniProt ID Q9NQT6
Background	FSCN3 acts as an actin bundling protein.
Synonyms	actin-bundling protein; fascin (testis); fascin 3; fascin homolog 3; OTTMUSP00000023543; testicular (Strongylocentrotus purpuratus)
Note	Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%; Rat: 86%; Mouse: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.