TSKS Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TSKS Antibody: synthetic peptide directed towards the middle region of human TSKS. Synthetic peptide located within the following region: ALRLLGGLGGRVDGFLGQWERAQREQAQTARDLQELRGRADELCTMVERS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	65 kDa
Gene Name	testis specific serine kinase substrate
Database Link	NP_068379 Entrez Gene 60385 Human UniProt ID Q9UJT2
Background	TSKS may play a role in testicular physiology, spermatogenesis or spermiogenesis. Expression of the TSKS is highest in the testis and down-regulated in testicular cancer. The gene encoded TSKS is localized to the region 19q13.3 among the related RAS viral oncogene homolog (RRAS) and interferon regulatory factor 3 (IRF3) genes, which are both involved in tumorigenesis pathways and progression.This gene may play a role in testicular physiology, spermatogenesis or spermiogenesis. Expression of the encoded protein is highest in the testis and down-regulated in testicular cancer. The gene is localized to the region 19q13.3 among the related RAS viral oncogene homolog (RRAS) and interferon regulatory factor 3 (IRF3) genes, which are both involved in tumorigenesis pathways and progression.
Synonyms	PPP1R161; STK22S1; TSKS1; TSSKS
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Pig: 86%; Rat: 86%; Mouse: 86%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.