C20orf195 (FNDC11) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-C20orf195 Antibody: synthetic peptide directed towards the N terminal of human C20orf195. Synthetic peptide located within the following region: RMKKVGTAQTKIQLLLLGDLLEQLDHGRAELDALLRSPDPRPFLADWALV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	chromosome 20 open reading frame 195
Database Link	NP_076964 Entrez Gene 79025 Human UniProt ID Q9BVV2
Background	The exact function of C20orf195 remains unknown.
Synonyms	MGC5356
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Pig: 86%; Guinea pig: 86%; Rat: 85%; Mouse: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.