TAF7L Rabbit Polyclonal Antibody
CAT#: TA335457
Rabbit Polyclonal Anti-TAF7L Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-TAF7L Antibody: synthetic peptide directed towards the middle region of human TAF7L. Synthetic peptide located within the following region: QKQIEKKEKKLHKIQNKAQRQKDLIMKVENLTLKNHFQSVLEQLELQEKQ |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 51 kDa |
Gene Name | TATA-box binding protein associated factor 7 like |
Database Link | |
Background | TAF7L gene is similar to a mouse gene that encodes a TATA box binding protein-associated factor, and shows testis-specific expression.This gene is similar to a mouse gene that encodes a TATA box binding protein-associated factor, and shows testis-specific expression. |
Synonyms | CT40; TAF2Q |
Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Dog: 92%; Rat: 91%; Mouse: 91%; Bovine: 79% |
Reference Data | |
Protein Families | Transcription Factors |
Protein Pathways | Basal transcription factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |